PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1711s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 151aa    MW: 17352.6 Da    PI: 9.9837
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1711s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-0846851655
                            HHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox 16 eelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55
                            e+ Fe+++ +  +    LA++l+L  r+V+ WFq rRa+e
  SapurV1A.1711s0040.1.p 46 ENIFEEDNRIPNSIQLSLAEQLNLVPRKVQDWFQKRRARE 85
                            67899966666666778*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.8E-43992IPR001356Homeobox domain
PROSITE profilePS5007110.6734688IPR001356Homeobox domain
CDDcd000863.19E-54689No hitNo description
PfamPF000463.6E-64685IPR001356Homeobox domain
SuperFamilySSF466892.92E-74685IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-84890IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MDFERVRGGG SAGKKRDLEL ESGQASSSSN DGAENPLVQK KPRFSENIFE EDNRIPNSIQ  60
LSLAEQLNLV PRKVQDWFQK RRAREMSKQM DYEILKEDNE LLKKANERLR RQIEFLIPLV  120
KSPPRKIPPS RERIQRAFSP CSDESSTPIQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-13homeobox from Arabidopsis thaliana